PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627476.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 251aa    MW: 28990.3 Da    PI: 10.1499
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627476.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-161964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed+ l ++v+q+G+++W+ Ia+++  gR++k+c++rw++ 
   XP_013627476.1 19 RGHWRPIEDDHLRQLVEQYGPKNWNFIAQHLY-GRSGKSCRLRWYNQ 64
                     899****************************9.************96 PP

2Myb_DNA-binding53.65.3e-1771114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE+e+l++a++  G++ W++Iar ++ gRt++ +k++++ 
   XP_013627476.1  71 KKPFTEEEEERLLQAHRFQGNR-WASIARLFP-GRTDNAVKNHFHV 114
                      689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.2061469IPR017930Myb domain
SMARTSM007176.0E-131867IPR001005SANT/Myb domain
SuperFamilySSF466891.16E-2818112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-252072IPR009057Homeodomain-like
PfamPF139211.7E-162282No hitNo description
CDDcd001675.86E-122263No hitNo description
SMARTSM007175.6E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129417.30270120IPR017930Myb domain
CDDcd001671.94E-1073113No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2073118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDMSTGSNSF DNKKISCQRG HWRPIEDDHL RQLVEQYGPK NWNFIAQHLY GRSGKSCRLR  60
WYNQLDPNIT KKPFTEEEEE RLLQAHRFQG NRWASIARLF PGRTDNAVKN HFHVIMARRK  120
RESSSSTATS TFNQSWHNIL SHSSSLTRLD RSQFGLWTYQ KDKSRGLWPY TFVPAPKDGQ  180
FGSSSISNLQ KDIYPERIKS KELVDHHNYE FQAATPDHKK NSISEDGPSM GNNGGKKNVT  240
FIDFLGVGLL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-34191194104MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-341911958158MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-341911958158MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-34191194104C-Myb DNA-Binding Domain
1msf_C2e-34191194104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627476.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D3BLM60.0A0A0D3BLM6_BRAOL; Uncharacterized protein
STRINGBra034565.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.11e-156myb domain protein 69